PPP6C monoclonal antibody (M01), clone 1B7
  • PPP6C monoclonal antibody (M01), clone 1B7

PPP6C monoclonal antibody (M01), clone 1B7

Ref: AB-H00005537-M01
PPP6C monoclonal antibody (M01), clone 1B7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PPP6C.
Información adicional
Size 100 ug
Gene Name PPP6C
Gene Alias FLJ92648|MGC12249
Gene Description protein phosphatase 6, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP6C (AAH06990, 1 a.a. ~ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5537
Clone Number 1B7
Iso type IgG2b Kappa

Enviar un mensaje


PPP6C monoclonal antibody (M01), clone 1B7

PPP6C monoclonal antibody (M01), clone 1B7