PPP5C purified MaxPab rabbit polyclonal antibody (D01P)
  • PPP5C purified MaxPab rabbit polyclonal antibody (D01P)

PPP5C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005536-D01P
PPP5C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP5C protein.
Información adicional
Size 100 ug
Gene Name PPP5C
Gene Alias FLJ36922|PP5|PPP5
Gene Description protein phosphatase 5, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP5C (NP_006238.1, 1 a.a. ~ 499 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5536

Enviar un mensaje


PPP5C purified MaxPab rabbit polyclonal antibody (D01P)

PPP5C purified MaxPab rabbit polyclonal antibody (D01P)