PPP5C polyclonal antibody (A01)
  • PPP5C polyclonal antibody (A01)

PPP5C polyclonal antibody (A01)

Ref: AB-H00005536-A01
PPP5C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PPP5C.
Información adicional
Size 50 uL
Gene Name PPP5C
Gene Alias FLJ36922|PP5|PPP5
Gene Description protein phosphatase 5, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP5C (AAH01970, 1 a.a. ~ 499 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5536

Enviar un mensaje


PPP5C polyclonal antibody (A01)

PPP5C polyclonal antibody (A01)