PPP3R2 monoclonal antibody (M07), clone 5D9
  • PPP3R2 monoclonal antibody (M07), clone 5D9

PPP3R2 monoclonal antibody (M07), clone 5D9

Ref: AB-H00005535-M07
PPP3R2 monoclonal antibody (M07), clone 5D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP3R2.
Información adicional
Size 100 ug
Gene Name PPP3R2
Gene Alias PPP3RL
Gene Description protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP3R2 (NP_671709, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5535
Clone Number 5D9
Iso type IgG2a Kappa

Enviar un mensaje


PPP3R2 monoclonal antibody (M07), clone 5D9

PPP3R2 monoclonal antibody (M07), clone 5D9