PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)

PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005534-D01P
PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP3R1 protein.
Información adicional
Size 100 ug
Gene Name PPP3R1
Gene Alias CALNB1|CNB|CNB1
Gene Description protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP3R1 (NP_000936.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5534

Enviar un mensaje


PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)

PPP3R1 purified MaxPab rabbit polyclonal antibody (D01P)