PPP3CC monoclonal antibody (M01), clone 4D1
  • PPP3CC monoclonal antibody (M01), clone 4D1

PPP3CC monoclonal antibody (M01), clone 4D1

Ref: AB-H00005533-M01
PPP3CC monoclonal antibody (M01), clone 4D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP3CC.
Información adicional
Size 100 ug
Gene Name PPP3CC
Gene Alias CALNA3
Gene Description protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5533
Clone Number 4D1
Iso type IgG1 Kappa

Enviar un mensaje


PPP3CC monoclonal antibody (M01), clone 4D1

PPP3CC monoclonal antibody (M01), clone 4D1