Ver mas grande
PPP3CC monoclonal antibody (M01), clone 4D1
AB-H00005533-M01
Producto nuevo
PPP3CC monoclonal antibody (M01), clone 4D1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PPP3CC |
| Gene Alias | CALNA3 |
| Gene Description | protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5533 |
| Clone Number | 4D1 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PPP3CC.