PPP4C polyclonal antibody (A01)
  • PPP4C polyclonal antibody (A01)

PPP4C polyclonal antibody (A01)

Ref: AB-H00005531-A01
PPP4C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Información adicional
Size 50 uL
Gene Name PPP4C
Gene Alias PP4|PPH3|PPX
Gene Description protein phosphatase 4 (formerly X), catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP4C (NP_002711, 218 a.a. ~ 307 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5531

Enviar un mensaje


PPP4C polyclonal antibody (A01)

PPP4C polyclonal antibody (A01)