PPP2R5C monoclonal antibody (M01), clone 3G9
  • PPP2R5C monoclonal antibody (M01), clone 3G9

PPP2R5C monoclonal antibody (M01), clone 3G9

Ref: AB-H00005527-M01
PPP2R5C monoclonal antibody (M01), clone 3G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPP2R5C.
Información adicional
Size 100 ug
Gene Name PPP2R5C
Gene Alias B56G|MGC23064|PR61G
Gene Description protein phosphatase 2, regulatory subunit B', gamma isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP2R5C (NP_002710.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5527
Clone Number 3G9
Iso type IgG2a Kappa

Enviar un mensaje


PPP2R5C monoclonal antibody (M01), clone 3G9

PPP2R5C monoclonal antibody (M01), clone 3G9