PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)

PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005524-D01P
PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPP2R4 protein.
Información adicional
Size 100 ug
Gene Name PPP2R4
Gene Alias MGC2184|PP2A|PR53|PTPA
Gene Description protein phosphatase 2A activator, regulatory subunit 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP2R4 (NP_066954.2, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5524

Enviar un mensaje


PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)

PPP2R4 purified MaxPab rabbit polyclonal antibody (D01P)