PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)
  • PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)

PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005519-B01P
PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP2R1B protein.
Información adicional
Size 50 ug
Gene Name PPP2R1B
Gene Alias MGC26454|PR65B
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP2R1B (NP_002707, 1 a.a. ~ 601 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5519

Enviar un mensaje


PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)

PPP2R1B purified MaxPab mouse polyclonal antibody (B01P)