PPP1R2 polyclonal antibody (A01)
  • PPP1R2 polyclonal antibody (A01)

PPP1R2 polyclonal antibody (A01)

Ref: AB-H00005504-A01
PPP1R2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPP1R2.
Información adicional
Size 50 uL
Gene Name PPP1R2
Gene Alias IPP2|MGC87148
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5504

Enviar un mensaje


PPP1R2 polyclonal antibody (A01)

PPP1R2 polyclonal antibody (A01)