PPP1CB purified MaxPab mouse polyclonal antibody (B01P)
  • PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005500-B01P
PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP1CB protein.
Información adicional
Size 50 ug
Gene Name PPP1CB
Gene Alias MGC3672|PP-1B|PPP1CD
Gene Description protein phosphatase 1, catalytic subunit, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5500

Enviar un mensaje


PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

PPP1CB purified MaxPab mouse polyclonal antibody (B01P)