PPOX monoclonal antibody (M07), clone 1G2
  • PPOX monoclonal antibody (M07), clone 1G2

PPOX monoclonal antibody (M07), clone 1G2

Ref: AB-H00005498-M07
PPOX monoclonal antibody (M07), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPOX.
Información adicional
Size 100 ug
Gene Name PPOX
Gene Alias MGC8485|PPO|V290M|VP
Gene Description protoporphyrinogen oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5498
Clone Number 1G2
Iso type IgG2a Kappa

Enviar un mensaje


PPOX monoclonal antibody (M07), clone 1G2

PPOX monoclonal antibody (M07), clone 1G2