PPOX monoclonal antibody (M01), clone 2F10
  • PPOX monoclonal antibody (M01), clone 2F10

PPOX monoclonal antibody (M01), clone 2F10

Ref: AB-H00005498-M01
PPOX monoclonal antibody (M01), clone 2F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPOX.
Información adicional
Size 100 ug
Gene Name PPOX
Gene Alias MGC8485|PPO|V290M|VP
Gene Description protoporphyrinogen oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5498
Clone Number 2F10
Iso type IgG1 Kappa

Enviar un mensaje


PPOX monoclonal antibody (M01), clone 2F10

PPOX monoclonal antibody (M01), clone 2F10