PPM1B purified MaxPab rabbit polyclonal antibody (D01P)
  • PPM1B purified MaxPab rabbit polyclonal antibody (D01P)

PPM1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005495-D01P
PPM1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPM1B protein.
Información adicional
Size 100 ug
Gene Name PPM1B
Gene Alias MGC21657|PP2C-beta-X|PP2CB|PP2CBETA|PPC2BETAX
Gene Description protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPM1B (NP_002697.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5495

Enviar un mensaje


PPM1B purified MaxPab rabbit polyclonal antibody (D01P)

PPM1B purified MaxPab rabbit polyclonal antibody (D01P)