PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)

PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005475-D01P
PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPEF1 protein.
Información adicional
Size 100 ug
Gene Name PPEF1
Gene Alias PP7|PPEF|PPP7C
Gene Description protein phosphatase, EF-hand calcium binding domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPEF1 (NP_006231.2, 1 a.a. ~ 653 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5475

Enviar un mensaje


PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)

PPEF1 purified MaxPab rabbit polyclonal antibody (D01P)