PPA1 monoclonal antibody (M01), clone 3B2
  • PPA1 monoclonal antibody (M01), clone 3B2

PPA1 monoclonal antibody (M01), clone 3B2

Ref: AB-H00005464-M01
PPA1 monoclonal antibody (M01), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPA1.
Información adicional
Size 100 ug
Gene Name PPA1
Gene Alias IOPPP|MGC111556|PP|PP1|SID6-8061
Gene Description pyrophosphatase (inorganic) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPA1 (NP_066952, 10 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5464
Clone Number 3B2
Iso type IgG1 Kappa

Enviar un mensaje


PPA1 monoclonal antibody (M01), clone 3B2

PPA1 monoclonal antibody (M01), clone 3B2