POU6F1 purified MaxPab mouse polyclonal antibody (B01P)
  • POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005463-B01P
POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POU6F1 protein.
Información adicional
Size 50 ug
Gene Name POU6F1
Gene Alias BRN5|MPOU|TCFB1
Gene Description POU class 6 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POU6F1 (AAH74765.3, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5463

Enviar un mensaje


POU6F1 purified MaxPab mouse polyclonal antibody (B01P)

POU6F1 purified MaxPab mouse polyclonal antibody (B01P)