POU6F1 polyclonal antibody (A01)
  • POU6F1 polyclonal antibody (A01)

POU6F1 polyclonal antibody (A01)

Ref: AB-H00005463-A01
POU6F1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POU6F1.
Información adicional
Size 50 uL
Gene Name POU6F1
Gene Alias BRN5|MPOU|TCFB1
Gene Description POU class 6 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU6F1 (NP_002693, 193 a.a. ~ 301 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5463

Enviar un mensaje


POU6F1 polyclonal antibody (A01)

POU6F1 polyclonal antibody (A01)