POU5F1 monoclonal antibody (M04), clone 3A10
  • POU5F1 monoclonal antibody (M04), clone 3A10

POU5F1 monoclonal antibody (M04), clone 3A10

Ref: AB-H00005460-M04
POU5F1 monoclonal antibody (M04), clone 3A10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant POU5F1.
Información adicional
Size 100 ug
Gene Name POU5F1
Gene Alias MGC22487|OCT3|OCT4|OTF3|OTF4
Gene Description POU class 5 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5460
Clone Number 3A10
Iso type IgG2a Kappa

Enviar un mensaje


POU5F1 monoclonal antibody (M04), clone 3A10

POU5F1 monoclonal antibody (M04), clone 3A10