POU4F1 monoclonal antibody (M04), clone 7B4
  • POU4F1 monoclonal antibody (M04), clone 7B4

POU4F1 monoclonal antibody (M04), clone 7B4

Ref: AB-H00005457-M04
POU4F1 monoclonal antibody (M04), clone 7B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POU4F1.
Información adicional
Size 100 ug
Gene Name POU4F1
Gene Alias BRN3A|FLJ13449|Oct-T1|RDC-1
Gene Description POU class 4 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU4F1 (NP_006228.2, 331 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5457
Clone Number 7B4
Iso type IgG2a Kappa

Enviar un mensaje


POU4F1 monoclonal antibody (M04), clone 7B4

POU4F1 monoclonal antibody (M04), clone 7B4