PON1 monoclonal antibody (M08), clone 4C7
  • PON1 monoclonal antibody (M08), clone 4C7

PON1 monoclonal antibody (M08), clone 4C7

Ref: AB-H00005444-M08
PON1 monoclonal antibody (M08), clone 4C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PON1.
Información adicional
Size 100 ug
Gene Name PON1
Gene Alias ESA|PON
Gene Description paraoxonase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HVYEKHANWTLTPLKSLDFNTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PON1 (NP_000437, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5444
Clone Number 4C7
Iso type IgG1 Kappa

Enviar un mensaje


PON1 monoclonal antibody (M08), clone 4C7

PON1 monoclonal antibody (M08), clone 4C7