POLR2L purified MaxPab rabbit polyclonal antibody (D01P)
  • POLR2L purified MaxPab rabbit polyclonal antibody (D01P)

POLR2L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005441-D01P
POLR2L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLR2L protein.
Información adicional
Size 100 ug
Gene Name POLR2L
Gene Alias RBP10|RPABC5|RPB10|RPB10beta|RPB7.6|hRPB7.6|hsRPB10b
Gene Description polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR2L (NP_066951.1, 1 a.a. ~ 67 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5441

Enviar un mensaje


POLR2L purified MaxPab rabbit polyclonal antibody (D01P)

POLR2L purified MaxPab rabbit polyclonal antibody (D01P)