Ver mas grande
POLR2H MaxPab rabbit polyclonal antibody (D01)
AB-H00005437-D01
Producto nuevo
POLR2H MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | POLR2H |
| Gene Alias | RPABC3|RPB17|RPB8|hsRPB8 |
| Gene Description | polymerase (RNA) II (DNA directed) polypeptide H |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP |
| Immunogen Prot. Seq | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | POLR2H (NP_006223.2, 1 a.a. ~ 150 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 5437 |
Más información
Rabbit polyclonal antibody raised against a full-length human POLR2H protein.