POLR2H MaxPab rabbit polyclonal antibody (D01)
  • POLR2H MaxPab rabbit polyclonal antibody (D01)

POLR2H MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005437-D01
POLR2H MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLR2H protein.
Información adicional
Size 100 uL
Gene Name POLR2H
Gene Alias RPABC3|RPB17|RPB8|hsRPB8
Gene Description polymerase (RNA) II (DNA directed) polypeptide H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR2H (NP_006223.2, 1 a.a. ~ 150 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5437

Enviar un mensaje


POLR2H MaxPab rabbit polyclonal antibody (D01)

POLR2H MaxPab rabbit polyclonal antibody (D01)