POLE2 polyclonal antibody (A01)
  • POLE2 polyclonal antibody (A01)

POLE2 polyclonal antibody (A01)

Ref: AB-H00005427-A01
POLE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLE2.
Información adicional
Size 50 uL
Gene Name POLE2
Gene Alias DPE2
Gene Description polymerase (DNA directed), epsilon 2 (p59 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLE2 (NP_002683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5427

Enviar un mensaje


POLE2 polyclonal antibody (A01)

POLE2 polyclonal antibody (A01)