POLD2 purified MaxPab rabbit polyclonal antibody (D01P)
  • POLD2 purified MaxPab rabbit polyclonal antibody (D01P)

POLD2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005425-D01P
POLD2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLD2 protein.
Información adicional
Size 100 ug
Gene Name POLD2
Gene Alias -
Gene Description polymerase (DNA directed), delta 2, regulatory subunit 50kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLD2 (NP_006221.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5425

Enviar un mensaje


POLD2 purified MaxPab rabbit polyclonal antibody (D01P)

POLD2 purified MaxPab rabbit polyclonal antibody (D01P)