POLB polyclonal antibody (A01)
  • POLB polyclonal antibody (A01)

POLB polyclonal antibody (A01)

Ref: AB-H00005423-A01
POLB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLB.
Información adicional
Size 50 uL
Gene Name POLB
Gene Alias MGC125976
Gene Description polymerase (DNA directed), beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq ITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLB (AAI06910.1, 224 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5423

Enviar un mensaje


POLB polyclonal antibody (A01)

POLB polyclonal antibody (A01)