POLA monoclonal antibody (M01), clone 3C11
  • POLA monoclonal antibody (M01), clone 3C11

POLA monoclonal antibody (M01), clone 3C11

Ref: AB-H00005422-M01
POLA monoclonal antibody (M01), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POLA.
Información adicional
Size 100 ug
Gene Name POLA1
Gene Alias DKFZp686K1672|POLA|p180
Gene Description polymerase (DNA directed), alpha 1, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLA (NP_058633, 1363 a.a. ~ 1462 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5422
Clone Number 3C11
Iso type IgG2a Kappa

Enviar un mensaje


POLA monoclonal antibody (M01), clone 3C11

POLA monoclonal antibody (M01), clone 3C11