POLA polyclonal antibody (A01)
  • POLA polyclonal antibody (A01)

POLA polyclonal antibody (A01)

Ref: AB-H00005422-A01
POLA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLA.
Información adicional
Size 50 uL
Gene Name POLA1
Gene Alias DKFZp686K1672|POLA|p180
Gene Description polymerase (DNA directed), alpha 1, catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLA (NP_058633, 1363 a.a. ~ 1462 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5422

Enviar un mensaje


POLA polyclonal antibody (A01)

POLA polyclonal antibody (A01)