PNMT monoclonal antibody (M06), clone 3G4
  • PNMT monoclonal antibody (M06), clone 3G4

PNMT monoclonal antibody (M06), clone 3G4

Ref: AB-H00005409-M06
PNMT monoclonal antibody (M06), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PNMT.
Información adicional
Size 100 ug
Gene Name PNMT
Gene Alias MGC34570|PENT|PNMTase
Gene Description phenylethanolamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,ELISA
Immunogen Prot. Seq MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNMT (NP_002677, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5409
Clone Number 3G4
Iso type IgG2b Kappa

Enviar un mensaje


PNMT monoclonal antibody (M06), clone 3G4

PNMT monoclonal antibody (M06), clone 3G4