PNMT MaxPab rabbit polyclonal antibody (D01)
  • PNMT MaxPab rabbit polyclonal antibody (D01)

PNMT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005409-D01
PNMT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PNMT protein.
Información adicional
Size 100 uL
Gene Name PNMT
Gene Alias MGC34570|PENT|PNMTase
Gene Description phenylethanolamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNMT (NP_002677.1, 1 a.a. ~ 282 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5409

Enviar un mensaje


PNMT MaxPab rabbit polyclonal antibody (D01)

PNMT MaxPab rabbit polyclonal antibody (D01)