PNMT polyclonal antibody (A01)
  • PNMT polyclonal antibody (A01)

PNMT polyclonal antibody (A01)

Ref: AB-H00005409-A01
PNMT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PNMT.
Información adicional
Size 50 uL
Gene Name PNMT
Gene Alias MGC34570|PENT|PNMTase
Gene Description phenylethanolamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNMT (NP_002677, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5409

Enviar un mensaje


PNMT polyclonal antibody (A01)

PNMT polyclonal antibody (A01)