PNLIPRP2 monoclonal antibody (M03), clone 4F10
  • PNLIPRP2 monoclonal antibody (M03), clone 4F10

PNLIPRP2 monoclonal antibody (M03), clone 4F10

Ref: AB-H00005408-M03
PNLIPRP2 monoclonal antibody (M03), clone 4F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PNLIPRP2.
Información adicional
Size 100 ug
Gene Name PNLIPRP2
Gene Alias PLRP2
Gene Description pancreatic lipase-related protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNLIPRP2 (NP_005387, 333 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5408
Clone Number 4F10
Iso type IgG2b Kappa

Enviar un mensaje


PNLIPRP2 monoclonal antibody (M03), clone 4F10

PNLIPRP2 monoclonal antibody (M03), clone 4F10