PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)

PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005408-D01P
PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PNLIPRP2 protein.
Información adicional
Size 100 ug
Gene Name PNLIPRP2
Gene Alias PLRP2
Gene Description pancreatic lipase-related protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNLIPRP2 (AAH05989.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5408

Enviar un mensaje


PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)

PNLIPRP2 purified MaxPab rabbit polyclonal antibody (D01P)