PNLIPRP2 polyclonal antibody (A01)
  • PNLIPRP2 polyclonal antibody (A01)

PNLIPRP2 polyclonal antibody (A01)

Ref: AB-H00005408-A01
PNLIPRP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PNLIPRP2.
Información adicional
Size 50 uL
Gene Name PNLIPRP2
Gene Alias PLRP2
Gene Description pancreatic lipase-related protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNLIPRP2 (NP_005387, 333 a.a. ~ 435 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5408

Enviar un mensaje


PNLIPRP2 polyclonal antibody (A01)

PNLIPRP2 polyclonal antibody (A01)