PNLIP purified MaxPab rabbit polyclonal antibody (D01P)
  • PNLIP purified MaxPab rabbit polyclonal antibody (D01P)

PNLIP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005406-D01P
PNLIP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PNLIP protein.
Información adicional
Size 100 ug
Gene Name PNLIP
Gene Alias PL
Gene Description pancreatic lipase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNLIP (AAH14309.1, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5406

Enviar un mensaje


PNLIP purified MaxPab rabbit polyclonal antibody (D01P)

PNLIP purified MaxPab rabbit polyclonal antibody (D01P)