PRRX1 polyclonal antibody (A01)
  • PRRX1 polyclonal antibody (A01)

PRRX1 polyclonal antibody (A01)

Ref: AB-H00005396-A01
PRRX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRRX1.
Información adicional
Size 50 uL
Gene Name PRRX1
Gene Alias PHOX1|PMX1|PRX1
Gene Description paired related homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRRX1 (NP_073207, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5396

Enviar un mensaje


PRRX1 polyclonal antibody (A01)

PRRX1 polyclonal antibody (A01)