PMS1 monoclonal antibody (M01), clone 2G10
  • PMS1 monoclonal antibody (M01), clone 2G10

PMS1 monoclonal antibody (M01), clone 2G10

Ref: AB-H00005378-M01
PMS1 monoclonal antibody (M01), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PMS1.
Información adicional
Size 100 ug
Gene Name PMS1
Gene Alias DKFZp781M0253|FLJ98259|HNPCC3|PMSL1|hPMS1
Gene Description PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PMS1 (NP_000525, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5378
Clone Number 2G10
Iso type IgG1 Kappa

Enviar un mensaje


PMS1 monoclonal antibody (M01), clone 2G10

PMS1 monoclonal antibody (M01), clone 2G10