PMS1 polyclonal antibody (A01)
  • PMS1 polyclonal antibody (A01)

PMS1 polyclonal antibody (A01)

Ref: AB-H00005378-A01
PMS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PMS1.
Información adicional
Size 50 uL
Gene Name PMS1
Gene Alias DKFZp781M0253|FLJ98259|HNPCC3|PMSL1|hPMS1
Gene Description PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PMS1 (NP_000525, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5378

Enviar un mensaje


PMS1 polyclonal antibody (A01)

PMS1 polyclonal antibody (A01)