PML polyclonal antibody (A01)
  • PML polyclonal antibody (A01)

PML polyclonal antibody (A01)

Ref: AB-H00005371-A01
PML polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PML.
Información adicional
Size 50 uL
Gene Name PML
Gene Alias MYL|PP8675|RNF71|TRIM19
Gene Description promyelocytic leukemia
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5371

Enviar un mensaje


PML polyclonal antibody (A01)

PML polyclonal antibody (A01)