PLTP purified MaxPab rabbit polyclonal antibody (D01P)
  • PLTP purified MaxPab rabbit polyclonal antibody (D01P)

PLTP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005360-D01P
PLTP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLTP protein.
Información adicional
Size 100 ug
Gene Name PLTP
Gene Alias HDLCQ9
Gene Description phospholipid transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLTP (AAH19898.1, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5360

Enviar un mensaje


PLTP purified MaxPab rabbit polyclonal antibody (D01P)

PLTP purified MaxPab rabbit polyclonal antibody (D01P)