PLRG1 monoclonal antibody (M06), clone 7H2
  • PLRG1 monoclonal antibody (M06), clone 7H2

PLRG1 monoclonal antibody (M06), clone 7H2

Ref: AB-H00005356-M06
PLRG1 monoclonal antibody (M06), clone 7H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLRG1.
Información adicional
Size 100 ug
Gene Name PLRG1
Gene Alias MGC110980|PRL1
Gene Description pleiotropic regulator 1 (PRL1 homolog, Arabidopsis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PPGPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWHPPWKLYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLRG1 (NP_002660, 101 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5356
Clone Number 7H2
Iso type IgG2a Kappa

Enviar un mensaje


PLRG1 monoclonal antibody (M06), clone 7H2

PLRG1 monoclonal antibody (M06), clone 7H2