PLOD1 polyclonal antibody (A01)
  • PLOD1 polyclonal antibody (A01)

PLOD1 polyclonal antibody (A01)

Ref: AB-H00005351-A01
PLOD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLOD1.
Información adicional
Size 50 uL
Gene Name PLOD1
Gene Alias FLJ42041|LH|LH1|LLH|PLOD
Gene Description procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLOD1 (NP_000293, 19 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5351

Enviar un mensaje


PLOD1 polyclonal antibody (A01)

PLOD1 polyclonal antibody (A01)