FXYD3 purified MaxPab mouse polyclonal antibody (B01P)
  • FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005349-B01P
FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FXYD3 protein.
Información adicional
Size 50 ug
Gene Name FXYD3
Gene Alias MAT-8|MAT8|MGC111076|PLML
Gene Description FXYD domain containing ion transport regulator 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FXYD3 (AAH05238, 21 a.a. ~ 87 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5349

Enviar un mensaje


FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

FXYD3 purified MaxPab mouse polyclonal antibody (B01P)