PLEK monoclonal antibody (M03), clone 2D8
  • PLEK monoclonal antibody (M03), clone 2D8

PLEK monoclonal antibody (M03), clone 2D8

Ref: AB-H00005341-M03
PLEK monoclonal antibody (M03), clone 2D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLEK.
Información adicional
Size 100 ug
Gene Name PLEK
Gene Alias FLJ27168|P47
Gene Description pleckstrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEK (AAH18549, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5341
Clone Number 2D8
Iso type IgG2a Kappa

Enviar un mensaje


PLEK monoclonal antibody (M03), clone 2D8

PLEK monoclonal antibody (M03), clone 2D8