PLG MaxPab rabbit polyclonal antibody (D01)
  • PLG MaxPab rabbit polyclonal antibody (D01)

PLG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005340-D01
PLG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLG protein.
Información adicional
Size 100 uL
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLG (NP_000292.1, 1 a.a. ~ 810 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5340

Enviar un mensaje


PLG MaxPab rabbit polyclonal antibody (D01)

PLG MaxPab rabbit polyclonal antibody (D01)