PLD1 polyclonal antibody (A01)
  • PLD1 polyclonal antibody (A01)

PLD1 polyclonal antibody (A01)

Ref: AB-H00005337-A01
PLD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLD1.
Información adicional
Size 50 uL
Gene Name PLD1
Gene Alias -
Gene Description phospholipase D1, phosphatidylcholine-specific
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5337

Enviar un mensaje


PLD1 polyclonal antibody (A01)

PLD1 polyclonal antibody (A01)