PLCG1 monoclonal antibody (M01), clone 2A2
  • PLCG1 monoclonal antibody (M01), clone 2A2

PLCG1 monoclonal antibody (M01), clone 2A2

Ref: AB-H00005335-M01
PLCG1 monoclonal antibody (M01), clone 2A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLCG1.
Información adicional
Size 100 ug
Gene Name PLCG1
Gene Alias PLC-II|PLC1|PLC148|PLCgamma1
Gene Description phospholipase C, gamma 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5335
Clone Number 2A2
Iso type IgG1 kappa

Enviar un mensaje


PLCG1 monoclonal antibody (M01), clone 2A2

PLCG1 monoclonal antibody (M01), clone 2A2