PLCD1 polyclonal antibody (A01)
  • PLCD1 polyclonal antibody (A01)

PLCD1 polyclonal antibody (A01)

Ref: AB-H00005333-A01
PLCD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLCD1.
Información adicional
Size 50 uL
Gene Name PLCD1
Gene Alias -
Gene Description phospholipase C, delta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCD1 (AAH50382, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5333

Enviar un mensaje


PLCD1 polyclonal antibody (A01)

PLCD1 polyclonal antibody (A01)