PLCD1 polyclonal antibody (A01) Ver mas grande

PLCD1 polyclonal antibody (A01)

AB-H00005333-A01

Producto nuevo

PLCD1 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name PLCD1
Gene Alias -
Gene Description phospholipase C, delta 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCD1 (AAH50382, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5333

Más información

Mouse polyclonal antibody raised against a partial recombinant PLCD1.

Consulta sobre un producto

PLCD1 polyclonal antibody (A01)

PLCD1 polyclonal antibody (A01)