PLAUR monoclonal antibody (M04), clone 1D6
  • PLAUR monoclonal antibody (M04), clone 1D6

PLAUR monoclonal antibody (M04), clone 1D6

Ref: AB-H00005329-M04
PLAUR monoclonal antibody (M04), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PLAUR.
Información adicional
Size 100 ug
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAUR (AAH02788, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.2
Gene ID 5329
Clone Number 1D6
Iso type IgG2a Kappa

Enviar un mensaje


PLAUR monoclonal antibody (M04), clone 1D6

PLAUR monoclonal antibody (M04), clone 1D6